PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G2116
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 248aa    MW: 27113.2 Da    PI: 6.5009
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G2116genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.78.7e-20162195134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  Gh_D08G2116 162 CTHCEVTKTPQWREGPKGPKTLCNACGVRYRSGR 195
                  *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-17156206IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-15158218No hitNo description
Gene3DG3DSA:3.30.50.105.0E-15160193IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.846160192IPR000679Zinc finger, GATA-type
CDDcd002022.08E-15161208No hitNo description
PROSITE patternPS003440162187IPR000679Zinc finger, GATA-type
PfamPF003201.1E-17162195IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MNNSWFNKCF DGFGVNDGLF DDVVKYLDFP LEDVEGTDDD GASGEGVVKD FHLPLGDVED  60
KSYVGGGGDD GGEDWDCSTW FQTSSPVSVL ETSSACSSAK PAPINPKLSF LVKRDRSKRR  120
RASTFNLQFT LPFISSTGST SLVGSCEIDK SSSEETAVVR KCTHCEVTKT PQWREGPKGP  180
KTLCNACGVR YRSGRLFPEY RPAASPTFVP SLHSNSHKKV IEMRKQCQAA EVGNTIYGVN  240
STRNRNAV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.49851e-134boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443598.16e-77PREDICTED: GATA transcription factor 11-like
TrEMBLA0A0D2PGV01e-112A0A0D2PGV0_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-49GATA transcription factor 11